PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013588574.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 333aa    MW: 37297.4 Da    PI: 6.8396
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013588574.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding574.4e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd  lv +++q+G+g+W+++++  g+ R+ k+c++rw +yl
   XP_013588574.1 14 KGPWTPEEDITLVSYIQQHGPGNWRSVPKNTGLLRCSKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding49.78.3e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+ E++ ++++ ++lG++ W++Ia++++  Rt++++k++w+++l
   XP_013588574.1  67 RGNFTQHEEKTIIHLQALLGNR-WAAIASYLP-QRTDNDIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.229965IPR017930Myb domain
SuperFamilySSF466893.67E-3013108IPR009057Homeodomain-like
SMARTSM007171.7E-141363IPR001005SANT/Myb domain
PfamPF002491.7E-161461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.4E-241568IPR009057Homeodomain-like
CDDcd001672.06E-111661No hitNo description
PROSITE profilePS5129419.22266116IPR017930Myb domain
SMARTSM007175.4E-1566114IPR001005SANT/Myb domain
PfamPF002492.8E-1467112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-2469116IPR009057Homeodomain-like
CDDcd001672.26E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0010200Biological Processresponse to chitin
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MGRPPCCEKI VVKKGPWTPE EDITLVSYIQ QHGPGNWRSV PKNTGLLRCS KSCRLRWTNY  60
LRPGIKRGNF TQHEEKTIIH LQALLGNRWA AIASYLPQRT DNDIKNYWNT HLKKKLQLQR  120
QNGITNEDNT DMTEMSSCNN NNHVCTNSKR IANKGKWEKK LQTDINMAKQ ALFQALSLDQ  180
PTSSISPDLG SPKPHHHSAT ATYASSTDNI SKLLQNWTSS SSSVPYTSSY SNNRSSSTGE  240
GGVLDQHALF SPSSETGSVD EKLNLMTETS IFKGESKPIV DTEATTDDHS SLSLIEKWLF  300
DDQGMVQCDD DQEDLTDVSL QGKNTDNNCQ DVF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C7e-261411627128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00235DAPTransfer from AT1G74650Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM9756530.0KM975653.1 Brassica napus MYB transcription factor 31.1 (MYB31.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013588574.10.0PREDICTED: myb-related protein 306-like
RefseqXP_013700637.10.0PREDICTED: myb-related protein 306-like
SwissprotP813921e-104MYB06_ANTMA; Myb-related protein 306
TrEMBLA0A0D3D0P10.0A0A0D3D0P1_BRAOL; Uncharacterized protein
STRINGBra015899.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74650.11e-173myb domain protein 31